1. Recombinant Proteins
  2. Others
  3. NINJ1 Protein, Mouse (Cell-Free, His)

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of NINJ1 Protein, Mouse (Cell-Free, His) is 152 a.a., with molecular weight of 19&35&57&76&114 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of NINJ1 Protein, Mouse (Cell-Free, His) is 152 a.a., with molecular weight of 19&35&57&76&114 kDa.

Background

NINJ1 Protein serves as a pivotal effector in programmed cell death, mediating plasma membrane rupture in necroptosis and pyroptosis. Downstream of Gasdermin or MLKL activation, NINJ1 oligomerizes in response to death stimuli, introducing hydrophilic faces of two alpha helices into the hydrophobic membrane, leading to the release of damage-associated molecular patterns (DAMPs) and propagating the inflammatory response. Additionally, NINJ1 acts as a regulator of Toll-like receptor 4 (TLR4) signaling during systemic inflammation by directly binding lipopolysaccharide (LPS). It contributes to leukocyte migration, transendothelial migration of macrophages, and promotes monocyte migration to central nervous system inflammatory lesions. Functioning as a homophilic transmembrane adhesion molecule, NINJ1 is involved in axonal growth, cell chemotaxis, angiogenesis, and cell-to-cell interactions between immune cells and endothelial cells. It plays diverse roles in nerve regeneration, angiogenesis, vascular formation, osteoclast development, striated muscle growth, and differentiation. The secreted form exhibits chemotactic activity and acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby ameliorating atherosclerosis.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

O70131 (M1-Q152)

Gene ID

18081

Molecular Construction
N-term
10*His
NINJ1 (M1-Q152)
Accession # O70131
C-term
Synonyms
Ninjurin-1; Nerve injury-induced protein 1
AA Sequence

MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

Molecular Weight

19 kDa&35 kDa&57 kDa&76 kDa&114 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NINJ1 Protein, Mouse (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NINJ1 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702385
Quantity:
MCE Japan Authorized Agent: