NIP30 Protein, Human (HEK293, His)

The NIP30 protein negatively regulates proteasomal protein catabolism and protein binding activity. It is located in the nucleus and is expressed in various tissues including the brain and testis. NIP30 Protein, Human (HEK293, His) is the recombinant human-derived NIP30 protein, expressed by HEK293 , with C-His labeled tag. The total length of NIP30 Protein, Human (HEK293, His) is 254 a.a., with molecular weight (glycosylation form) of ~35-43 kDa.

The NIP30 protein is involved in the negative regulation of proteasomal protein catabolic process and negative regulation of protein binding activity. It is located in the nucleus. The NIP30 protein shows ubiquitous expression in tissues such as the brain, testis, and 25 other tissues.

Human

HEK293

C-His

NP_079222 (M1-P254)

80011

MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP

Approximately 35-43 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 25 mM Tris-HCL, pH 7.3, 10% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.