1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. NKG2A/CD159a
  5. NKG2A Protein, Mouse (HEK293, His)

NKG2A Protein, a crucial immune inhibitory receptor, forms a complex with KLRD1 on lymphocyte subsets for self-nonself discrimination.Recognizing HLA-E loaded with self-peptides, it monitors MHC class I expression in healthy cells, promoting self-tolerance.NKG2A transmits signals through ITIMs, recruiting tyrosine phosphatases to counteractivate receptors.As a key inhibitor on NK cells, it regulates their functions, distinguishing harmless from pathogenic antigens.In the tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to cell exhaustion.During viral infection, it inhibits NK cell cytotoxicity, facilitating viral immune escape.NKG2A Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKG2A protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKG2A Protein, a crucial immune inhibitory receptor, forms a complex with KLRD1 on lymphocyte subsets for self-nonself discrimination.Recognizing HLA-E loaded with self-peptides, it monitors MHC class I expression in healthy cells, promoting self-tolerance.NKG2A transmits signals through ITIMs, recruiting tyrosine phosphatases to counteractivate receptors.As a key inhibitor on NK cells, it regulates their functions, distinguishing harmless from pathogenic antigens.In the tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to cell exhaustion.During viral infection, it inhibits NK cell cytotoxicity, facilitating viral immune escape.NKG2A Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKG2A protein, expressed by HEK293 , with N-His labeled tag.

Background

NKG2A, an immune inhibitory receptor crucial for self-nonself discrimination, forms a complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides from the signal sequence of classical MHC class Ia molecules. This recognition allows cytotoxic cells to monitor MHC class I expression in healthy cells and promotes self-tolerance. Upon binding to HLA-E-peptide complexes, NKG2A transmits intracellular signals through two immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHP-1 and INPPL1/SHP-2 tyrosine phosphatases to oppose signals from activating receptors. As a key inhibitory receptor on natural killer (NK) cells, NKG2A regulates their activation and effector functions, countering T cell receptor signaling on a subset of memory/effector CD8-positive T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a phenomenon known as cell exhaustion. Notably, during viral infection, NKG2A recognizes HLA-E in complex with human cytomegalovirus-derived peptides, inhibiting NK cell cytotoxicity and facilitating viral immune escape[1][2][3][4].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse NKG2A is immobilized at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant human CD94 Protein. The ED50 for this effect is 0.5737 μg/mL

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse NKG2A is immobilized at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant human CD94 Protein. The ED50 for this effect is 0.5737 μg/mL.
Species

Mouse

Source

HEK293

Tag

N-His

Accession

Q9WU31 (A94-I244)

Gene ID

16641

Molecular Construction
N-term
His
NKG2A (A94-I244)
Accession # Q9WU31
C-term
Synonyms
NKG2-A/NKG2-B type II integral membrane protein; CD159a; KLRC1
AA Sequence

ATPYNEANAQINSSMTRTHRDINYTLSSAQPCPHCPKEWISYSHNCYFIGMERKSWNDSLVSCISKNCSLLHIDSEEEQDFLQSLSLVSWTGILRKGRGQPWVWKKDSIFKPKIAEILHDECNCAMMSASGLTADSCTTLHPYLCKCKFPI

Molecular Weight

33-40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKG2A Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2A Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74690
Quantity:
MCE Japan Authorized Agent: