NKp30/NCR3 Protein, Rat (HEK293, His)

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Rat (HEK293, His) is the recombinant rat-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag. The total length of NKp30/NCR3 Protein, Rat (HEK293, His) is 129 a.a., with molecular weight of ~25-33 KDa.

NKp30/NCR3 protein, serving as a cell membrane receptor on natural killer (NK) cells, becomes activated upon binding extracellular ligands such as BAG6 and NCR3LG1. Upon ligand binding, NKp30/NCR3 stimulates NK cell cytotoxicity against neighboring cells expressing these ligands, thereby exerting control over NK cell cytotoxicity against tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that failed to acquire a mature phenotype but also promotes DC maturation. This occurs through the release of TNFA and IFNG by NK cells, further contributing to the maturation process. In its unliganded form, NKp30/NCR3 forms homodimers and interacts with CD3Z, as well as with and is activated by binding to both NCR3LG1 and BAG6, unraveling its intricate roles in regulating immune responses, NK cell cytotoxicity, and DC maturation.

Measured by its binding ability in a functional ELISA. When Recombinant Rat NKp30/NCR3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Human B7-H6. The ED₅₀ for this effect is 42.39 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Rat NKp30/NCR3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Human B7-H6. The ED₅₀ for this effect is 42.39 ng/mL.

Rat

HEK293

C-His

Q8CFD9 (I19-S147)

294251  [NCBI]

IWVSQPPEIRAQEGTTASLPCSFNASRGKAAIGSATWYQDKVAPGMELSNVTPGFRGRVASFSASQFIRGHKAGLLIQDIQSHDARIYVCRVEVLGLGVGTGNGTRLVVEKEPPQQASNAEPERAAYTS

Approximately 25-33 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE. It migrates as an approximately 25-33 kDa band in SDS-PAGE under reducing conditions.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.