NKp80/KLRF1 Protein, Cynomolgus (HEK293, Fc)

NKp80/KLRF1 Protein plays a pivotal role in the natural killer (NK)-mediated cytolysis of PHA-induced lymphoblasts, highlighting its significance in immune response. As a homodimer, it structurally arranges in cells. Its involvement in NK-mediated cytolysis contributes to the immune system's ability to eliminate specific cell populations, enhancing cellular defense mechanisms. NKp80/KLRF1 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived NKp80/KLRF1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of NKp80/KLRF1 Protein, Cynomolgus (HEK293, Fc) is 166 a.a., with molecular weight of ~53-75 kDa.

NKp80/KLRF1 Protein is intricately linked to the natural killer (NK)-mediated cytolysis of PHA-induced lymphoblasts, playing a pivotal role in this immune response. The protein functions as a homodimer, highlighting its structural arrangement in the cellular context. Its involvement in NK-mediated cytolysis emphasizes its significance in the immune system's ability to target and eliminate specific cell populations, contributing to the intricate network of cellular defense mechanisms.

Measured by the ability of the immobilized protein to support the adhesion of U937 cells. When 5 x 10⁴ cells/well are added to Recombinant Cynomolgus NKp80 coated plates (5 µg/mL, 100 µL/well), 67.36% cells will adhere after 1 hour incubation.

Cynomolgus

HEK293

N-hFc

Q8MI05 (V66-Y231)

102141941  [NCBI]

VLLKCQKGSHSNTTEHEDIGDLKMNNGTRRNTSNKDLCVSRSADQTVLCQSEWLKYRGKCYWFSNEMKSWSDSYVYCLERKSHLLIIQDELEMAFIQKNLRQSNYVWMGLNFTSLKMTWTWVDGSPLDPKIFFIKGPAKENSCAAIKESKIYSETCSSVFKWICQY

Approximately 53-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.