1. Recombinant Proteins
  2. Receptor Proteins
  3. NKp80/KLRF1 Protein, Human (HEK293, His)

NKp80/KLRF1 Protein, Human (HEK293, His)

Cat. No.: HY-P72501
SDS COA Handling Instructions

The NKp80/KLRF1 protein is critically involved in NK-mediated PHA-induced cytolysis of lymphoblasts, emphasizing its importance in immune responses against activated cells. Its involvement suggests a role in identifying and targeting specific cellular targets for elimination. NKp80/KLRF1 Protein, Human (HEK293, His) is the recombinant human-derived NKp80/KLRF1 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKp80/KLRF1 protein is critically involved in NK-mediated PHA-induced cytolysis of lymphoblasts, emphasizing its importance in immune responses against activated cells. Its involvement suggests a role in identifying and targeting specific cellular targets for elimination. NKp80/KLRF1 Protein, Human (HEK293, His) is the recombinant human-derived NKp80/KLRF1 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

The NKp80/KLRF1 Protein plays a crucial role in the natural killer (NK)-mediated cytolysis of PHA-induced lymphoblasts, underscoring its significance in the immune response against aberrant or activated cells. This involvement suggests NKp80/KLRF1's function in recognizing and targeting specific cellular targets for elimination through NK-mediated cytolysis. Additionally, the protein exists as a homodimer, emphasizing its structural configuration and potential implications for its functional activities in the context of immune surveillance and the elimination of target cells by NK cells.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q9NZS2-1 (V66-Y231)

Gene ID
Molecular Construction
N-term
6*His
NKp80 (V66-Y231)
Accession # Q9NZS2-1
C-term
Synonyms
Killer cell lectin-like receptor subfamily F member 1; Activating coreceptor NKp80; KLRF1; CLEC5C; ML
AA Sequence

VLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY

Molecular Weight

25-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKp80/KLRF1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp80/KLRF1 Protein, Human (HEK293, His)
Cat. No.:
HY-P72501
Quantity:
MCE Japan Authorized Agent: