NKp80/KLRF1 Protein, Human (HEK293, His)

The NKp80/KLRF1 protein is critically involved in NK-mediated PHA-induced cytolysis of lymphoblasts, emphasizing its importance in immune responses against activated cells. Its involvement suggests a role in identifying and targeting specific cellular targets for elimination. NKp80/KLRF1 Protein, Human (HEK293, His) is the recombinant human-derived NKp80/KLRF1 protein, expressed by HEK293 , with N-6*His labeled tag.

The NKp80/KLRF1 Protein plays a crucial role in the natural killer (NK)-mediated cytolysis of PHA-induced lymphoblasts, underscoring its significance in the immune response against aberrant or activated cells. This involvement suggests NKp80/KLRF1's function in recognizing and targeting specific cellular targets for elimination through NK-mediated cytolysis. Additionally, the protein exists as a homodimer, emphasizing its structural configuration and potential implications for its functional activities in the context of immune surveillance and the elimination of target cells by NK cells.

Human

HEK293

N-6*His

Q9NZS2-1 (V66-Y231)

51348  [NCBI]

VLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY

25-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.