Nodal Protein, Mouse

Nodal protein plays a key role in embryonic development and is integral for mesoderm formation and axial patterning. Its involvement in these fundamental processes underscores its importance in coordinating the complex series of events that determine early embryonic morphogenesis. Nodal Protein, Mouse is the recombinant mouse-derived Nodal protein, expressed by E. coli , with tag free.

The nodal protein is a pivotal player in embryonic development, serving as a critical factor in both mesoderm formation and axial patterning. This protein functions as a homodimer, forming a robust molecular structure where two identical subunits are intricately linked through disulfide bonds. The nodal signaling pathway, mediated by this protein, is instrumental in guiding fundamental processes such as cell differentiation into the mesodermal lineage and the establishment of axial patterns in developing embryos. This regulatory role underscores the significance of the nodal protein in orchestrating the intricate dance of cellular events during embryogenesis, highlighting its essential contributions to the proper organization and development of tissues and structures in the early stages of life.

Measured by its ability to induce Smad2 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 100 ng/mL of Recombinant Mouse Nodal can effictively induce Smad2 phosphorylation.

Mouse

E. coli

Tag Free

P43021 (H245-L354)

18119  [NCBI]

HHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 4 mM HCL, pH 2.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 50 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.