1. Recombinant Proteins
  2. Others
  3. Nodal Protein, Mouse

Nodal protein plays a key role in embryonic development and is integral for mesoderm formation and axial patterning. Its involvement in these fundamental processes underscores its importance in coordinating the complex series of events that determine early embryonic morphogenesis. Nodal Protein, Mouse is the recombinant mouse-derived Nodal protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nodal protein plays a key role in embryonic development and is integral for mesoderm formation and axial patterning. Its involvement in these fundamental processes underscores its importance in coordinating the complex series of events that determine early embryonic morphogenesis. Nodal Protein, Mouse is the recombinant mouse-derived Nodal protein, expressed by E. coli , with tag free.

Background

The nodal protein is a pivotal player in embryonic development, serving as a critical factor in both mesoderm formation and axial patterning. This protein functions as a homodimer, forming a robust molecular structure where two identical subunits are intricately linked through disulfide bonds. The nodal signaling pathway, mediated by this protein, is instrumental in guiding fundamental processes such as cell differentiation into the mesodermal lineage and the establishment of axial patterns in developing embryos. This regulatory role underscores the significance of the nodal protein in orchestrating the intricate dance of cellular events during embryogenesis, highlighting its essential contributions to the proper organization and development of tissues and structures in the early stages of life.

Biological Activity

Measured by its ability to induce Smad2 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 100 ng/mL of Recombinant Mouse Nodal can effictively induce Smad2 phosphorylation.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P43021 (H245-L354)

Gene ID
Molecular Construction
N-term
Nodal (H245-L354)
Accession # P43021
C-term
Synonyms
Nodal; Tg.413d
AA Sequence

HHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCL, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 50 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Nodal Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nodal Protein, Mouse
Cat. No.:
HY-P79080
Quantity:
MCE Japan Authorized Agent: