Noggin Protein, Human (CHO)

Noggin Protein, Human (CHO) is an antagonist of bone morphogenetic proteins (BMPs), binds with high affinity to hBMP-4, and with lower affinity to hBMP-7; Noggin Protein is essential for proper skeletal development.

Human Noggin protein has 205 amino acids (residues 28-232) after removal of its signal sequence (residues 1-27) and is secreted as a glycosylated, covalently linked homodimer, binds with high affinity to hBMP-4, and with lower affinity to hBMP-7 and acts as an antagonist of bone morphogenetic proteins (BMPs)^[1]. Noggin is essential for proper skeletal development; excess BMP activity in the Noggin null mutant results in excess cartilage and failure to initiate joint formation^[2].

1.ED₅₀ < 2.5 ng/mL, measured in a bioassay using ATDC5 cells in the presence of 10 ng/mL human BMP-4. 2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is 0.002519 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is 3.970×10⁵ units/mg.

• 
  Measured by its ability to inhbit BMP-4-induced alkalnephosphatase production by ATDC5 mouse chondrogenic cells in the presence of Recombinant Human BMP-4 (40 ng/mL), with an ED₅₀ of 4 ng/mL.

Human

CHO

Tag Free

Q13253 (Q28-C232)

9241  [NCBI]

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 25-31 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420(6916):636-42.  [Content Brief]

  [2]. Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280(5368):1455-7.  [Content Brief]