1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Human (CHO)

Noggin Protein, Human (CHO)

Cat. No.: HY-P7051A
COA Handling Instructions

Noggin Protein, Human (CHO) is an antagonist of bone morphogenetic proteins (BMPs), binds with high affinity to hBMP-4, and with lower affinity to hBMP-7; Noggin Protein is essential for proper skeletal development.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $45 In-stock
10 μg $120 In-stock
50 μg $460 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Noggin Protein, Human (CHO) is an antagonist of bone morphogenetic proteins (BMPs), binds with high affinity to hBMP-4, and with lower affinity to hBMP-7; Noggin Protein is essential for proper skeletal development.

Background

Human Noggin protein has 205 amino acids (residues 28-232) after removal of its signal sequence (residues 1-27) and is secreted as a glycosylated, covalently linked homodimer, binds with high affinity to hBMP-4, and with lower affinity to hBMP-7 and acts as an antagonist of bone morphogenetic proteins (BMPs)[1]. Noggin is essential for proper skeletal development; excess BMP activity in the Noggin null mutant results in excess cartilage and failure to initiate joint formation[2].

Biological Activity

1.ED50 < 2.5 ng/mL, measured in a bioassay using ATDC5 cells in the presence of 10 ng/mL human BMP-4. 2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.002519 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is 3.970×105 units/mg.

  • Measured by its ability to inhbit BMP-4-induced alkalnephosphatase production by ATDC5 mouse chondrogenic cells in the presence of Recombinant Human BMP-4 (40 ng/mL), with an ED50 of 4 ng/mL.
Species

Human

Source

CHO

Tag

Tag Free

Accession

Q13253 (Q28-C232)

Gene ID
Molecular Construction
N-term
Noggin (Q28-C232)
Accession # Q13253
C-term
Synonyms
rHuNoggin; NOG
AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Weight

Approximately 25-31 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Noggin Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Human (CHO)
Cat. No.:
HY-P7051A
Quantity:
MCE Japan Authorized Agent: