1. Recombinant Proteins
  2. Receptor Proteins
  3. Nogo Receptor/NgR Protein, Mouse (HEK293, His)

Nogo Receptor/NgR Protein, Mouse (HEK293, His)

Cat. No.: HY-P71158
SDS COA Handling Instructions Technical Support

Nogo receptor/NgR proteins act as receptors for RTN4, OMG, MAG, and sialylated gangliosides. It also binds chondroitin sulfate proteoglycans and heparin. Nogo Receptor/NgR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Nogo Receptor/NgR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Nogo Receptor/NgR Protein, Mouse (HEK293, His) is 421 a.a., with molecular weight of 75-85 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nogo receptor/NgR proteins act as receptors for RTN4, OMG, MAG, and sialylated gangliosides. It also binds chondroitin sulfate proteoglycans and heparin. Nogo Receptor/NgR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Nogo Receptor/NgR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Nogo Receptor/NgR Protein, Mouse (HEK293, His) is 421 a.a., with molecular weight of 75-85 kDa.

Background

The Nogo Receptor/NgR Protein serves as a receptor for RTN4, OMG, and MAG, as well as for the sialylated gangliosides GT1b and GM1. Additionally, it functions as a receptor for chondroitin sulfate proteoglycans and can bind heparin. Intracellular signaling cascades are initiated through the coreceptor NGFR, leading to the activation of Rho and subsequent reorganization of the actin cytoskeleton. This signaling mechanism mediates axonal growth inhibition and plays a crucial role in regulating axon regeneration and neuronal plasticity within the adult central nervous system. Furthermore, Nogo Receptor/NgR is involved in postnatal brain development, playing a necessary role in axon migration across the brain midline and the formation of the corpus callosum. It also provides protection against apoptosis for motoneurons, potentially through interaction with MAG. Working in conjunction with RTN4 and LINGO1, it regulates neuronal precursor cell motility during cortical development. Like other family members, Nogo Receptor/NgR contributes to restricting the number of dendritic spines and synapses formed during brain development. It forms homodimers and interacts with various proteins, including MAG, RTN4, NGFR, LINGO1, and OLFM1, highlighting its multifaceted roles in cellular signaling and neural development.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q99PI8 (C27-S447)

Gene ID
Molecular Construction
N-term
NgR (C27-S447)
Accession # Q99PI8
6*His
C-term
Synonyms
Reticulon-4 Receptor; Nogo Receptor; NgR; Nogo-66 Receptor; RTN4R; NOGOR
AA Sequence

CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGPFRPIQTSQLTDEELLSLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDTPPGNGSGPRHINDSPFGTLPSSAEPPLTALRPGGSEPPGLPTTGPRRRPGCSRKNRTRSHCRLGQAGSGASGTGDAEGS

Molecular Weight

75-85 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Nogo Receptor/NgR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nogo Receptor/NgR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71158
Quantity:
MCE Japan Authorized Agent: