Norrin Protein, Mouse

Norrin protein is a key component of the canonical Wnt signaling pathway, activating the cascade by interacting with the FZD4 receptor and LRP5 coreceptor. Its role in retinal vascularization includes serving as a FZD4 ligand, stabilizing β-catenin (CTNNB1), and initiating LEF/TCF-mediated transcription. Norrin Protein, Mouse is the recombinant mouse-derived Norrin protein, expressed by E. coli , with tag free. The total length of Norrin Protein, Mouse is 107 a.a., with molecular weight of ~13 kDa.

Norrin protein, a pivotal player in the canonical Wnt signaling pathway, activates this cascade through its interactions with the FZD4 receptor and the LRP5 coreceptor. Its central role in retinal vascularization is orchestrated by acting as a ligand for FZD4, thereby stabilizing beta-catenin (CTNNB1) and initiating LEF/TCF-mediated transcriptional programs. Collaborating with TSPAN12, Norrin demonstrates a unique ability to activate FZD4 independently of canonical Wnt signaling, suggesting the existence of an alternative, Wnt-independent pathway that also contributes to beta-catenin accumulation. Beyond its involvement in retinal vascularization, Norrin may participate in a broader regulatory network influencing neural cell differentiation and proliferation, as well as potential roles in neuroectodermal cell-cell interactions. Structurally, Norrin forms homodimers linked by disulfide bonds and is part of a larger complex containing TSPAN12, FZD4, LRP5/6, and itself, highlighting its multifaceted interactions within the cellular signaling landscape.

Mouse

E. coli

Tag Free

P48744 (K25-S131)

17986  [NCBI]

KTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.