NPY Protein, Human (HEK293, His)

NPY protein is related to feeding behavior and GnRH secretion, and plays a crucial role in complex neural circuits that control appetite and energy balance. Its effects on GnRH secretion suggest a multifaceted role in the interplay between neural and endocrine pathways, particularly during reproduction. NPY Protein, Human (HEK293, His) is the recombinant human-derived NPY protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NPY Protein, Human (HEK293, His) is 69 a.a., with molecular weight of ~13.0 kDa.

NPY Protein is implicated in the regulation of feeding behavior and the secretion of gonadotrophin-releasing hormone (GnRH). Its involvement in the control of feeding suggests a key role in the complex neural circuits that modulate appetite and energy balance. Additionally, NPY's influence on GnRH secretion underscores its potential impact on reproductive processes, highlighting its multifaceted role in the intricate interplay between neural and endocrine pathways. Further research is essential to fully elucidate the molecular mechanisms through which NPY exerts its effects on feeding control and GnRH secretion, providing insights into its broader physiological functions.

Human

HEK293

C-6*His

P01303 (Y29-W97)

4852  [NCBI]

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Approximately 13.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.