1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. NRAS Protein, Human (His, solution)

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag. The total length of NRAS Protein, Human (His, solution) is 186 a.a., with molecular weight of ~24 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE NRAS Protein, Human (His, solution)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag. The total length of NRAS Protein, Human (His, solution) is 186 a.a., with molecular weight of ~24 kDa.

Background

NRAS, a member of the Ras protein family, is characterized by its ability to bind GDP/GTP and possess intrinsic GTPase activity. This inherent property allows NRAS to actively participate in cellular processes by regulating the cycling between GDP-bound inactive and GTP-bound active states. The dynamic interplay of NRAS with guanine nucleotides underscores its role as a molecular switch, influencing downstream signaling pathways and cellular responses. As a key component in signal transduction cascades, NRAS contributes to the intricate regulation of cellular functions and plays a crucial role in various physiological and pathological processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

P01111 (M1-C186)

Gene ID
Molecular Construction
N-term
His
NRAS (M1-C186)
Accession # P01111
C-term
Synonyms
GTPase Nras; Transforming protein N-Ras; NRAS; HRAS1
AA Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Molecular Weight

Approximately 24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 0.1M NaCl, 10% Glycerol, pH 7.5.

Endotoxin Level

>1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

NRAS Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRAS Protein, Human (His, solution)
Cat. No.:
HY-P73741
Quantity:
MCE Japan Authorized Agent: