NRG1-beta 2 Protein, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free. The total length of NRG1-beta 2 Protein, Human is 61 a.a., with molecular weight of ~7.0 kDa.

HRG1-β1 activates HER2/HER3 signaling and up-regulate Fn14 gene expression in parental MCF7 cells. HRG1-β1-mediated Fn14 up-regulation in MCF7/HER2-18 cells is required for maximal MMP-9 production.

The ED₅₀ is <50 ng/mL as measured by serum free human MCF-7 cells, corresponding to a specific activity of > 2.0×10⁴ units/mg.

• 
  Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 33.72 ng/mL. corresponding to a specific activity is 2.96×10⁴ units/mg.

Human

E. coli

Tag Free

Q02297-7 (S177-Q237)/E5RIG8 (S23-Q83)

3084  [NCBI]

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Approximately 8.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution in 20 mM PB, pH 7.0, containing 0.5 % HAS and 2 % mannitol or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.