Neurotrophin-4 Protein, Human

NT-4 Protein, Human is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR).

Neurotrophin-4 (NT-4) is a member of the well-studied family of neurotrophins that regulate the development of neuronal networks by participating in the growth of neuronal processes, synaptic development and plasticity, neuronal survival, differentiation, as well as myelination. Neurotrophin-4 binds with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR)^[1].

1. The ED₅₀ is <5 μg/mL as measured by C6 cells, corresponding to a specific activity of >2.0 × 10² units/mg.
2. Measured by its binding ability in a functional ELISA. When Recombinant Human Neurotrophin-4 is present at 5 μg/mL, can bind Recombinant Mouse TrkB. The ED₅₀ for this effect is 8.676 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human Neurotrophin-4 is present at 5 μg/mL, can bind Recombinant Mouse TrkB. The ED₅₀ for this effect is 8.676 ng/mL.

Human

E. coli

Tag Free

P34130 (G81-A210)

4909  [NCBI]

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<0.3 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.  [Content Brief]