NT-4 Protein, Mouse

NT-4 Protein, Mouse is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR).

Neurotrophin-4 (NT-4) is a member of the well-studied family of neurotrophins that regulate the development of neuronal networks by participating in the growth of neuronal processes, synaptic development and plasticity, neuronal survival, differentiation, as well as myelination. Neurotrophin-4 binds with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR)^[1].

The ED₅₀ is <1 μg/mL as measured by C6 cells, corresponding to a specific activity of >1.0 × 10³ units/mg.

Mouse

E. coli

Tag Free

Q80VU4 (G80-A209)

78405  [NCBI]

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 50 mM acetic acid.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O or 50 mM acetic acid. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.  [Content Brief]