1. Recombinant Proteins
  2. Others
  3. NucA Protein, S. marcescens

NucA Protein, S. marcescens

Cat. No.: HY-P78955
Handling Instructions

The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free. The total length of NucA Protein, S. marcescens is 266 a.a., with molecular weight of ~29 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free. The total length of NucA Protein, S. marcescens is 266 a.a., with molecular weight of ~29 kDa.

Background

NucA is an enzyme that catalyzes the hydrolysis of both DNA and RNA, targeting the 3' position of the phosphodiester bond and producing 5'-phosphorylated mono-, di-, tri-, and tetranucleotides. It exhibits activity on both double- and single-stranded nucleic acids, with DNA being a slightly more favorable substrate compared to RNA. NucA's ability to cleave phosphodiester bonds in nucleic acids results in the generation of smaller nucleotide fragments. This enzymatic activity suggests a role in nucleic acid metabolism, potentially contributing to the turnover and recycling of nucleotide components within the cell. It has to succinctly describe NucA's substrate specificity and its capacity to hydrolyze both DNA and RNA at the 3' position of the phosphodiester bond, emphasizing its role in nucleic acid cleavage.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

P13717 (M1-N266)

Gene ID

87005285

Molecular Construction
N-term
NucA (M1-N266)
Accession # P13717
C-term
Synonyms
Nuclease; nucA; Endonuclease; nuc; Benzonase Nuclease
AA Sequence

MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

Molecular Weight

Approximately 29 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NucA Protein, S. marcescens Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NucA Protein, S. marcescens
Cat. No.:
HY-P78955
Quantity:
MCE Japan Authorized Agent: