1. Recombinant Proteins
  2. Viral Proteins
  3. Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc)

Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc)

Cat. No.: HY-P72268
SDS COA Handling Instructions Technical Support

Nucleoprotein/NP proteins play a crucial role in assembling viral particles and facilitating the packaging of positive-strand viral genomic RNA into helical ribonucleocapsids (RNPs). Its interaction with the viral genome and membrane protein M is critical for virion assembly. Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-Myc, N-10*His labeled tag. The total length of Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) is 377 a.a., with molecular weight of ~ 46.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nucleoprotein/NP proteins play a crucial role in assembling viral particles and facilitating the packaging of positive-strand viral genomic RNA into helical ribonucleocapsids (RNPs). Its interaction with the viral genome and membrane protein M is critical for virion assembly. Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-Myc, N-10*His labeled tag. The total length of Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) is 377 a.a., with molecular weight of ~ 46.3 kDa.

Background

Nucleoprotein/NP Protein is a crucial player in the assembly of viral particles, orchestrating the packaging of the positive-strand viral genome RNA into a helical ribonucleocapsid (RNP). Its intricate interactions with the viral genome and the membrane protein M are fundamental to the virion assembly process. Beyond its structural role, NP Protein significantly contributes to the efficiency of subgenomic viral RNA transcription and overall viral replication. Existing as both monomeric and oligomeric forms, NP Protein forms homooligomers and engages in direct interactions with RNA. Furthermore, its association with NSP3 serves to tether the genome to the newly translated replicase-transcriptase complex at the early stages of infection, further highlighting its multifaceted involvement in the viral life cycle.

Species

Virus

Source

Sf9 insect cells

Tag

C-Myc;N-10*His

Accession

Q6Q1R8 (M1-H377)

Gene ID

2943504  [NCBI]

Molecular Construction
N-term
10*His
Nucleoprotein (M1-H377)
Accession # Q6Q1R8
C-term
Synonyms
Protein N
AA Sequence

MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH

Molecular Weight

Approximately 46.3kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc)
Cat. No.:
HY-P72268
Quantity:
MCE Japan Authorized Agent: