Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc)

Nucleoprotein/NP proteins play a crucial role in assembling viral particles and facilitating the packaging of positive-strand viral genomic RNA into helical ribonucleocapsids (RNPs). Its interaction with the viral genome and membrane protein M is critical for virion assembly. Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-Myc, N-10*His labeled tag. The total length of Nucleoprotein/NP Protein, HCoV-NL63 (Sf9, His, myc) is 377 a.a., with molecular weight of ~ 46.3 kDa.

Nucleoprotein/NP Protein is a crucial player in the assembly of viral particles, orchestrating the packaging of the positive-strand viral genome RNA into a helical ribonucleocapsid (RNP). Its intricate interactions with the viral genome and the membrane protein M are fundamental to the virion assembly process. Beyond its structural role, NP Protein significantly contributes to the efficiency of subgenomic viral RNA transcription and overall viral replication. Existing as both monomeric and oligomeric forms, NP Protein forms homooligomers and engages in direct interactions with RNA. Furthermore, its association with NSP3 serves to tether the genome to the newly translated replicase-transcriptase complex at the early stages of infection, further highlighting its multifaceted involvement in the viral life cycle.

Virus

Sf9 insect cells

C-Myc;N-10*His

Q6Q1R8 (M1-H377)

2943504  [NCBI]

MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH

Approximately 46.3kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.