1. Recombinant Proteins
  2. Others
  3. OARD1 Protein, Human (Myc, His)

OARD1 is an ADP:ATP antiporter that regulates mitochondrial energy dynamics by shuttling ADP for ATP synthesis and exporting ATP. It induces mitochondrial thermogenesis, uncouples proton flux and regulates ATP production efficiency. OARD1 Protein, Human (Myc, His) is the recombinant human-derived OARD1 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OARD1 is an ADP:ATP antiporter that regulates mitochondrial energy dynamics by shuttling ADP for ATP synthesis and exporting ATP. It induces mitochondrial thermogenesis, uncouples proton flux and regulates ATP production efficiency. OARD1 Protein, Human (Myc, His) is the recombinant human-derived OARD1 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

SLC25A5, an ADP:ATP antiporter, serves as a crucial mediator of mitochondrial energy dynamics, shuttling ADP into the mitochondrial matrix for ATP synthesis while exporting ATP to support cellular functions. Operating through the alternating access mechanism, it transitions between the cytoplasmic-open state (c-state) and the matrix-open state (m-state) at the inner mitochondrial membrane. Beyond its antiporter role, SLC25A5 contributes to mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Acting as a proton transporter, it induces mitochondrial thermogenesis by uncoupling proton flows via the electron transport chain and ATP synthase, thereby modulating ATP production efficiency. This proton transporter activity is finely regulated by the antiporter function, highlighting SLC25A5's role as a master regulator balancing ATP production and thermogenesis. SLC25A5's proton transport is facilitated by free fatty acids, acting as cofactors, without transporting them. Additionally, SLC25A5 plays a role in mitophagy regulation, independently of its antiporter activity, by promoting mitophagy through interaction with TIMM44 and inhibiting the presequence translocase TIMM23, leading to PINK1 stabilization. It is also implicated in chromosome segregation as part of the mitotic spindle-associated MMXD complex. Furthermore, SLC25A5 is involved in mPTP opening, contributing to cellular processes such as cell death, although its exact role in pore formation remains unclear.

Species

Human

Source

E. coli

Tag

N-His;C-Myc

Accession

Q9Y530 (A2-L152)

Gene ID
Molecular Construction
N-term
10*His
OARD1 (A2-L152)
Accession # Q9Y530
Myc
C-term
Synonyms
C6orf130; CF130_HUMAN; Chromosome 6 open reading frame 130; dJ34B21.3; O acetyl ADP ribose deacetylase C6orf130; Uncharacterized protein C6orf130
AA Sequence

ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

Molecular Weight

Approximately 24.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

OARD1 Protein, Human (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OARD1 Protein, Human (Myc, His)
Cat. No.:
HY-P71658
Quantity:
MCE Japan Authorized Agent: