OARD1 Protein, Human (Myc, His)

OARD1 is an ADP:ATP antiporter that regulates mitochondrial energy dynamics by shuttling ADP for ATP synthesis and exporting ATP. It induces mitochondrial thermogenesis, uncouples proton flux and regulates ATP production efficiency. OARD1 Protein, Human (Myc, His) is the recombinant human-derived OARD1 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

SLC25A5, an ADP:ATP antiporter, serves as a crucial mediator of mitochondrial energy dynamics, shuttling ADP into the mitochondrial matrix for ATP synthesis while exporting ATP to support cellular functions. Operating through the alternating access mechanism, it transitions between the cytoplasmic-open state (c-state) and the matrix-open state (m-state) at the inner mitochondrial membrane. Beyond its antiporter role, SLC25A5 contributes to mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Acting as a proton transporter, it induces mitochondrial thermogenesis by uncoupling proton flows via the electron transport chain and ATP synthase, thereby modulating ATP production efficiency. This proton transporter activity is finely regulated by the antiporter function, highlighting SLC25A5's role as a master regulator balancing ATP production and thermogenesis. SLC25A5's proton transport is facilitated by free fatty acids, acting as cofactors, without transporting them. Additionally, SLC25A5 plays a role in mitophagy regulation, independently of its antiporter activity, by promoting mitophagy through interaction with TIMM44 and inhibiting the presequence translocase TIMM23, leading to PINK1 stabilization. It is also implicated in chromosome segregation as part of the mitotic spindle-associated MMXD complex. Furthermore, SLC25A5 is involved in mPTP opening, contributing to cellular processes such as cell death, although its exact role in pore formation remains unclear.

Human

E. coli

N-His;C-Myc

Q9Y530 (A2-L152)

221443  [NCBI]

ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

Approximately 24.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.