OBP2B Protein, Human (HEK293, His)

The OBP2B protein may be involved in the binding and transport of small hydrophobic volatile molecules, suggesting a role in molecular recognition and transport, especially for lipophilic compounds. Its specificity implies involvement in sensory or signaling pathways in which recognition and transport of volatile compounds are crucial. OBP2B Protein, Human (HEK293, His) is the recombinant human-derived OBP2B protein, expressed by HEK293 , with C-His labeled tag.

The OBP2B protein is implicated in the probable binding and transportation of small hydrophobic volatile molecules. This suggests a role in molecular recognition and transport processes, particularly for small, lipophilic compounds. The specificity of OBP2B for such molecules implies its potential involvement in sensory or signaling pathways where the recognition and transport of volatile compounds are crucial. Further exploration of the ligands bound by OBP2B and the physiological contexts in which it operates will contribute to a more comprehensive understanding of its function in molecular transport and potential implications in cellular responses to environmental cues.

Human

HEK293

C-His

Q9NPH6-1 (L16-H170)

29989  [NCBI]

LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH

Approximately 20 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.