1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CLEC2D
  6. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi)

The OCIL/CLEC2D protein acts as a receptor for KLRB1 and protects target cells from natural killer cell-mediated lysis. It not only inhibits osteoclast formation and bone resorption, but also regulates the release of interferon-γ, indicating that it has immune and bone-related regulatory functions. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived OCIL/CLEC2D protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag. The total length of OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is 132 a.a., with molecular weight of 68-78 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The OCIL/CLEC2D protein acts as a receptor for KLRB1 and protects target cells from natural killer cell-mediated lysis. It not only inhibits osteoclast formation and bone resorption, but also regulates the release of interferon-γ, indicating that it has immune and bone-related regulatory functions. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived OCIL/CLEC2D protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag. The total length of OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is 132 a.a., with molecular weight of 68-78 kDa.

Background

OCIL/CLEC2D Protein serves as a receptor for KLRB1, providing protection to target cells against natural killer cell-mediated lysis. Not only does it inhibit osteoclast formation and bone resorption, but it also modulates the release of interferon-gamma, showcasing its regulatory role in immune responses and bone-related processes. Furthermore, OCIL/CLEC2D exhibits the ability to bind high molecular weight sulfated glycosaminoglycans, suggesting its involvement in interactions with extracellular components. Structurally, it exists as a homodimer with disulfide linkages, emphasizing the significance of its oligomeric form in mediating cellular functions associated with immune protection and bone homeostasis.

Species

Human

Source

HEK293

Tag

N-hFc;N-Avi

Accession

Q9UHP7-1 (R60-V191)

Gene ID
Molecular Construction
N-term
hFc-Avi
CLEC2D (R60-V191)
Accession # Q9UHP7-1
C-term
Synonyms
C-type lectin domain family 2 member D; Lectin-like NK cell receptor; Lectin-like transcript 1; LLT-1; CLAX; LLT1; OCIL; CLEC2D
AA Sequence

RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

Molecular Weight

68-78 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi)
Cat. No.:
HY-P77901
Quantity:
MCE Japan Authorized Agent: