1. Recombinant Proteins
  2. Others
  3. Odorant-binding protein/OBP Protein, Bovine (P.pastoris)

Odorant-binding protein/OBP Protein, Bovine (P.pastoris)

Cat. No.: HY-P71810
Handling Instructions Technical Support

Odor-binding proteins (OBPs) effectively bind a variety of odorants to form homodimers that enhance their function. OBP is crucial in the olfactory process, playing a key role in capturing odor molecules and contributing to the complex odor perception mechanism. Odorant-binding protein/OBP Protein, Bovine (P.pastoris) is the recombinant bovine-derived Odorant-binding protein/OBP protein, expressed by P. pastoris , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Odor-binding proteins (OBPs) effectively bind a variety of odorants to form homodimers that enhance their function. OBP is crucial in the olfactory process, playing a key role in capturing odor molecules and contributing to the complex odor perception mechanism. Odorant-binding protein/OBP Protein, Bovine (P.pastoris) is the recombinant bovine-derived Odorant-binding protein/OBP protein, expressed by P. pastoris , with tag free.

Background

The Odorant-binding protein (OBP) is characterized by its ability to bind a diverse range of chemical odorants. Structurally, it forms homodimers, underscoring its functional organization. As an essential component in olfactory processes, OBP plays a pivotal role in recognizing and capturing various odor molecules, contributing to the intricate mechanisms underlying the perception of scents. This homodimeric configuration likely enhances its efficiency in binding and transporting a wide spectrum of odorants, highlighting the significance of OBP in facilitating olfactory signaling and sensory perception.

Species

Bovine

Source

P. pastoris

Tag

Tag Free

Accession

P07435 (A1-E159)

Gene ID

/

Molecular Construction
N-term
OBP (A1-E159)
Accession # P07435
C-term
Synonyms
Odorant-binding protein; OBP; Olfactory mucosa pyrazine-binding protein
AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Molecular Weight

Approximately 34.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Odorant-binding protein/OBP Protein, Bovine (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Odorant-binding protein/OBP Protein, Bovine (P.pastoris)
Cat. No.:
HY-P71810
Quantity:
MCE Japan Authorized Agent: