Odorant-binding protein/OBP Protein, Bovine (P.pastoris)

Odor-binding proteins (OBPs) effectively bind a variety of odorants to form homodimers that enhance their function. OBP is crucial in the olfactory process, playing a key role in capturing odor molecules and contributing to the complex odor perception mechanism. Odorant-binding protein/OBP Protein, Bovine (P.pastoris) is the recombinant bovine-derived Odorant-binding protein/OBP protein, expressed by P. pastoris , with tag free.

The Odorant-binding protein (OBP) is characterized by its ability to bind a diverse range of chemical odorants. Structurally, it forms homodimers, underscoring its functional organization. As an essential component in olfactory processes, OBP plays a pivotal role in recognizing and capturing various odor molecules, contributing to the intricate mechanisms underlying the perception of scents. This homodimeric configuration likely enhances its efficiency in binding and transporting a wide spectrum of odorants, highlighting the significance of OBP in facilitating olfactory signaling and sensory perception.

Bovine

P. pastoris

Tag Free

P07435 (A1-E159)

/

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Approximately 34.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.