1. Recombinant Proteins
  2. Others
  3. Olfactory Marker Protein/OMP Protein, Human (His)

Olfactory Marker Protein/OMP Protein, Human (His)

Cat. No.: HY-P73736
Data Sheet Handling Instructions Technical Support

OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 75 In-stock
10 μg USD 125 In-stock
50 μg USD 355 In-stock
100 μg USD 600 In-stock
> 100 μg   Get quote  

Get it by tomorrow May 1 for select sizes. Order within 10 hrs 38 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag.

Background

The Olfactory Marker Protein (OMP) serves as a potential modulator within the olfactory signal-transduction cascade, playing a key role in fine-tuning olfactory signaling processes. In addition to its regulatory function, OMP interacts with BEX1 and BEX2, indicating a potential association with other proteins involved in cellular processes. This dual role highlights the multifaceted nature of OMP in influencing the intricacies of olfactory signal transduction, suggesting its involvement in the broader molecular network underlying olfactory function.

Species

Human

Source

E. coli

Tag

N-His

Accession

P47874 (M1-L163)

Gene ID
Molecular Construction
N-term
His
OMP (M1-L163)
Accession # P47874
C-term
Synonyms
Olfactory marker protein; Olfactory neuronal-specific protein; OMP
AA Sequence

MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

Molecular Weight

Approximately 19 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Olfactory Marker Protein/OMP Protein, Human (His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Olfactory Marker Protein/OMP Protein, Human (His)
Cat. No.:
HY-P73736
Quantity:
MCE Japan Authorized Agent: