Olfactory Marker Protein/OMP Protein, Human (His)

OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag. The total length of Olfactory Marker Protein/OMP Protein, Human (His) is 163 a.a., with molecular weight of ~19 kDa.

The Olfactory Marker Protein (OMP) serves as a potential modulator within the olfactory signal-transduction cascade, playing a key role in fine-tuning olfactory signaling processes. In addition to its regulatory function, OMP interacts with BEX1 and BEX2, indicating a potential association with other proteins involved in cellular processes. This dual role highlights the multifaceted nature of OMP in influencing the intricacies of olfactory signal transduction, suggesting its involvement in the broader molecular network underlying olfactory function.

Human

E. coli

N-His

P47874 (M1-L163)

4975  [NCBI]

MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

Approximately 19 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.