1. Recombinant Proteins
  2. Others
  3. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO)

Outer membrane protein A/OmpA Protein, E.coli (His-SUMO)

Cat. No.: HY-P71493
SDS COA Handling Instructions Technical Support

Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is 183 a.a., with molecular weight of ~35.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Outer membrane protein A/OmpA Protein, E.coli (His-SUMO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is 183 a.a., with molecular weight of ~35.6 kDa.

Background

Outer membrane protein A (OmpA) plays a crucial role in the structural integrity of the bacterial cell wall, working in concert with TolR to maintain the position of the peptidoglycan layer in the periplasm. Functioning as a porin, OmpA exhibits low permeability, facilitating the gradual penetration of small solutes through its structure. The internal gate within OmpA further regulates the passage of solutes, influencing the selective transport of molecules. Additionally, OmpA's significance extends to its involvement in conjugation with F-type plasmids, where it likely serves as the essential mating receptor on recipient cells, contributing to the horizontal transfer of genetic material.

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0A911 (W164-A346)

Gene ID

917123  [NCBI]

Molecular Construction
N-term
6*His-SUMO
OmpA (W164-A346)
Accession # P0A911
C-term
Synonyms
ompA; Z1307; ECs1041; Outer membrane protein A; Outer membrane porin A
AA Sequence

WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Molecular Weight

Approximately 35.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Outer membrane protein A/OmpA Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71493
Quantity:
MCE Japan Authorized Agent: