Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc)

Outer membrane protein C (OmpC) acts as a pore-forming protein that facilitates the passive diffusion of small molecules across the bacterial outer membrane. Notably, in Klebsiella pneumoniae, OmpC has been shown to bind the C1Q component and activate the classical pathway of the complement system. Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc) is the recombinant Outer membrane protein C/OmpC protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of Outer membrane protein C/OmpC Protein, Klebsiella pneumoniae (His, myc) is 342 a.a., with molecular weight of ~45.0 kDa.

The Outer membrane protein C (OmpC) is a homotrimeric protein integral to the outer membrane of bacteria, forming pores that enable the passive diffusion of small molecules. In Klebsiella pneumoniae, OmpC demonstrates additional functionality by binding to the C1Q component, thereby activating the classical pathway of the complement system. This interaction implicates OmpC in the modulation of the host immune response, showcasing its relevance beyond membrane permeability. The homotrimeric structure of OmpC underscores its stability and efficiency in facilitating the transport of molecules across the bacterial outer membrane.

Others

E. coli

N-10*His;C-Myc

Q48473 (A22-F363)

/

AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF

Approximately 45.0 kDa

• 
  Greater than 96% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.