Outer membrane protein F/OmpF Protein, E.coli (His, myc)

Outer membrane protein F (OmpF) facilitates the formation of pores, enabling the passive diffusion of small molecules across the bacterial outer membrane. Beyond its role in membrane permeability, OmpF serves as a crucial receptor for the bacteriophage T2 and is considered the primary receptor for colicin E5, playing a probable role in the mechanisms associated with these interactions. Outer membrane protein F/OmpF Protein, E.coli (His, myc) is the recombinant E. coli-derived Outer membrane protein F/OmpF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of Outer membrane protein F/OmpF Protein, E.coli (His, myc) is 340 a.a., with molecular weight of ~44.1 kDa.

The Outer membrane protein F (OmpF) plays a crucial role in bacterial physiology as it forms pores facilitating the passive diffusion of small molecules across the outer membrane. Serving as a key component in membrane permeability, OmpF contributes to the uptake of essential nutrients and substances by the bacterial cell. Furthermore, OmpF serves as a receptor for the bacteriophage T2, allowing the virus to recognize and infect the bacterial host. Additionally, there is a probable association between OmpF and colicin E5, where OmpF is identified as the major receptor for this bacteriocin. This dual functionality of OmpF in nutrient uptake and its interactions with bacteriophages and colicins underscores its significance in bacterial membrane dynamics and host-defense mechanisms.

E.coli

E. coli

C-Myc;N-10*His

P02931 (A23-F362)

61754051/945554  [NCBI]

AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

Approximately 44.1 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.