OX40 Ligand/TNFSF4 Protein, Human (HEK293)

OX40 Ligand/TNFSF4 Protein is a cytokine that binds specifically to TNFRSF4 and acts as a potent T-cell co-stimulator when OX40 Ligand is expressed in trimer form, promoting proliferation and cytokine production. Interactions with TNFRSF4 contribute to complex regulation, which is essential for regulating T cell function and enabling effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, which is unlabeled and a monomeric protein.

OX40 Ligand/TNFSF4 Protein is a cytokine that binds specifically to TNFRSF4 and acts as a potent T-cell co-stimulator when OX40 Ligand is expressed in trimer form, promoting proliferation and cytokine production. Interactions with TNFRSF4 contribute to complex regulation, which is essential for regulating T cell function and enabling effective and controlled immune activation.

Measured by its ability to induce IL-8 secretion in HT1080 human fibrosarcoma cells transfected with human OX40/TNFRSF4. The ED₅₀ for this effect is 3.527 ng/mL, corresponding to a specific activity is 2.836×10⁵ U/mg.

• 
  Measured by its ability to induce IL-8 secretion in HT1080 human fibrosarcoma cells transfected with human OX40/TNFRSF4. The ED₅₀ for this effect is 3.527 ng/mL, corresponding to a specific activity is 2.836×10⁵ U/mg.

Human

HEK293

Tag Free

P23510-1 (Q51-L183)

7292

QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Approximately 18-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.