OX40 Ligand/TNFSF4 Protein, Human (HEK293)

OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. Operating as a homotrimer, its engagement enhances immune response by activating and expanding T-cells. The interaction with TNFRSF4 contributes to intricate regulation, crucial for modulating T-cell functions and achieving effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with tag free. The total length of OX40 Ligand/TNFSF4 Protein, Human (HEK293) is 133 a.a., with molecular weight of 65-140 kDa.

The OX40 Ligand/TNFSF4 Protein, a cytokine, specifically binds to TNFRSF4 and functions as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its engagement with TNFRSF4 serves to enhance the immune response by promoting the activation and expansion of T-cells. The interaction between OX40 Ligand and its receptor TNFRSF4 contributes to the intricate regulation of T-cell-mediated immune responses, playing a crucial role in modulating T-cell functions for an effective and controlled immune activation.

Human

HEK293

Tag Free

P23510-1 (Q51-L183)

7292

QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Approximately 19-27 kDa

Greater than 95% as determined by SDS-PAGE.

<0.1 EU/μg, determined by LAL method.