OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc)

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is 143 a.a., with molecular weight of 44.9 kDa.

The OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, exerting its role as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its interaction with TNFRSF4 plays a pivotal role in enhancing the immune response by promoting the activation and expansion of T-cells. Through this engagement, OX40 Ligand contributes to the intricate regulation of T-cell-mediated immune responses, serving as a key mediator in modulating T-cell functions for effective and controlled immune activation.

Rabbit

HEK293

C-hFc

O02765 (Q45-P187)

100008595  [NCBI]

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

44.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.