OXT Protein, Human (P.pastoris, His)

OXT, or oxytocin, induces physiological effects by binding to neurophysin 1 and interacting with the oxytocin receptor (OXTR). This interaction results in smooth muscle contraction in the uterus and mammary gland, crucial for labor and breastfeeding, respectively, by modulating OXTR activity. OXT Protein, Human (P.pastoris, His) is the recombinant human-derived OXT protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of OXT Protein, Human (P.pastoris, His) is 94 a.a., with molecular weight of ~16 kDa.

OXT, or oxytocin, exerts its physiological effects through binding to neurophysin 1 and subsequently interacting with the oxytocin receptor (OXTR). This interaction leads to the contraction of smooth muscles in both the uterus and mammary gland. Oxytocin plays a crucial role in mediating uterine contractions during labor and facilitating milk ejection during breastfeeding by modulating the activity of the OXTR.

Human

P. pastoris

N-6*His

P01178 (32A-125R)

5020  [NCBI]

AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Approximately 16 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.