P-Selectin Protein, Rhesus Macaque (HEK293, Fc)

P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin^[1][2][3]. P-Selectin Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-hFc labeled tag.

P-selectin is an adhesion molecule located in the platelet a granule and Weibel-Palade body of endothelial cells. P-selectin mediates the rolling of blood cells on the surface of the endothelium and initiates the attachment of leukocytes circulating in the blood to platelets, endothelial cells,and other leukocytes at sites of tissue injury and inflammation. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin which is responsible for leukocyte rolling on active endothelium. Glycoprotein GPIb mediates platelet adhesion to subendothelium at sites of injury and the rolling of inactivated platelets on its activated surface. Sulfatides are ligands for P-selectin, which plays a role in platelet aggregation and adhesion^[2].

Rhesus Macaque

HEK293

C-hFc

XP_001094728.1 (W42-A771)

701277  [NCBI]

WTYHYSTKAYSWNTSRKYCQNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSKLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRVRGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTFGFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Approximately 106.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.