PADI2 Protein, Cynomolgus (sf9, His)

The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag. The total length of PADI2 Protein, Cynomolgus (sf9, His) is 665 a.a., with molecular weight of 66-70 kDa.

Peptidyl arginine deiminase 2 (PADI2) is an enzyme that catalyzes the deimination of arginine residues in proteins. This post-translational modification, also known as citrullination, involves the conversion of arginine to citrulline through the removal of an amino group. Citrullination plays a crucial role in various biological processes, including the regulation of gene expression, immune responses, and the formation of certain protein structures. PADI2-mediated deimination is implicated in the pathogenesis of autoimmune diseases such as rheumatoid arthritis, where citrullinated proteins are often targets of the immune system. It has to succinctly outline PADI2's catalytic function in introducing citrulline modifications to arginine residues, emphasizing its role in modulating protein structure and function.

Cynomolgus

sf9 insect cells

N-His

A0A2K5TST4 (M1-P665)

/

Full Length

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVMRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVCFQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP

66-70 kDa

Greater than 95% as determined by reduced SDS-PAGE.

<1 EU/μg, determined by LAL method.