PAFAHB Protein, Human (His)

PAFAHB Proteinas, incorporating Alpha-2 adrenergic receptors, facilitates catecholamine-induced adenylate cyclase inhibition through G proteins. Notably, oxymetazoline ranks as the most potent agonist, followed by clonidine and antagonists with yohimbine exhibiting the highest inhibitory activity. This insight into agonist and antagonist effectiveness sheds light on the pharmacological modulation of Alpha-2 adrenergic receptors by ADRA2A-VLPs. PAFAHB Protein, Human (His) is the recombinant human-derived PAFAHB protein, expressed by E. coli , with C-6*His labeled tag. The total length of PAFAHB Protein, Human (His) is 228 a.a., with molecular weight of ~31.0 kDa.

ADRA2A-VLPs, as a construct incorporating Alpha-2 adrenergic receptors, facilitate the catecholamine-induced inhibition of adenylate cyclase via G proteins. The receptor exhibits distinct agonist and antagonist pharmacological profiles. Among agonists, oxymetazoline demonstrates the highest potency, followed by clonidine, epinephrine, norepinephrine, phenylephrine, dopamine, p-synephrine, p-tyramine, serotonin, and p-octopamine. Conversely, antagonists show varying degrees of inhibitory activity, with yohimbine ranking as the most potent, followed by phentolamine, mianserine, chlorpromazine, spiperone, prazosin, propranolol, alprenolol, and pindolol. This delineation of agonist and antagonist effectiveness provides valuable insights into the pharmacological modulation of Alpha-2 adrenergic receptors mediated by ADRA2A-VLPs.

Human

E. coli

C-6*His

P68402 (S2-A229)

5049  [NCBI]

SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Approximately 31.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.