1. Recombinant Proteins
  2. Others
  3. PAFAHB Protein, Human (His)

PAFAHB Proteinas, incorporating Alpha-2 adrenergic receptors, facilitates catecholamine-induced adenylate cyclase inhibition through G proteins. Notably, oxymetazoline ranks as the most potent agonist, followed by clonidine and antagonists with yohimbine exhibiting the highest inhibitory activity. This insight into agonist and antagonist effectiveness sheds light on the pharmacological modulation of Alpha-2 adrenergic receptors by ADRA2A-VLPs. PAFAHB Protein, Human (His) is the recombinant human-derived PAFAHB protein, expressed by E. coli , with C-6*His labeled tag. The total length of PAFAHB Protein, Human (His) is 228 a.a., with molecular weight of ~31.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAFAHB Proteinas, incorporating Alpha-2 adrenergic receptors, facilitates catecholamine-induced adenylate cyclase inhibition through G proteins. Notably, oxymetazoline ranks as the most potent agonist, followed by clonidine and antagonists with yohimbine exhibiting the highest inhibitory activity. This insight into agonist and antagonist effectiveness sheds light on the pharmacological modulation of Alpha-2 adrenergic receptors by ADRA2A-VLPs. PAFAHB Protein, Human (His) is the recombinant human-derived PAFAHB protein, expressed by E. coli , with C-6*His labeled tag. The total length of PAFAHB Protein, Human (His) is 228 a.a., with molecular weight of ~31.0 kDa.

Background

ADRA2A-VLPs, as a construct incorporating Alpha-2 adrenergic receptors, facilitate the catecholamine-induced inhibition of adenylate cyclase via G proteins. The receptor exhibits distinct agonist and antagonist pharmacological profiles. Among agonists, oxymetazoline demonstrates the highest potency, followed by clonidine, epinephrine, norepinephrine, phenylephrine, dopamine, p-synephrine, p-tyramine, serotonin, and p-octopamine. Conversely, antagonists show varying degrees of inhibitory activity, with yohimbine ranking as the most potent, followed by phentolamine, mianserine, chlorpromazine, spiperone, prazosin, propranolol, alprenolol, and pindolol. This delineation of agonist and antagonist effectiveness provides valuable insights into the pharmacological modulation of Alpha-2 adrenergic receptors mediated by ADRA2A-VLPs.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P68402 (S2-A229)

Gene ID
Molecular Construction
N-term
PAFAHB (S2-A229)
Accession # P68402
6*His
C-term
Synonyms
Platelet-Activating Factor Acetylhydrolase IB Subunit Beta; PAF Acetylhydrolase 30 kDa Subunit; PAF-AH 30 kDa Subunit; PAF-AH Subunit Beta; PAFAH Subunit Beta; PAFAH1B2; PAFAHB
AA Sequence

SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Molecular Weight

Approximately 31.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PAFAHB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAFAHB Protein, Human (His)
Cat. No.:
HY-P71185
Quantity:
MCE Japan Authorized Agent: