Pal Protein, Legionella pneumophila (His-SUMO)

Pal protein, part of the Tol-Pal system, is pivotal in outer membrane invagination and maintenance of integrity during cell division. Integrated with TolA, TolQ, TolR, and TolB, the system connects inner and outer membranes to the peptidoglycan layer. Pal's strong association with peptidoglycan underscores its crucial role in the structural and functional dynamics of the Tol-Pal system. Pal Protein, Legionella pneumophila (His-SUMO) is the recombinant Pal protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Pal Protein, Legionella pneumophila (His-SUMO) is 155 a.a., with molecular weight (affected by relative charge) of ~36 kDa.

Pal protein is an integral component of the Tol-Pal system, contributing to outer membrane invagination during cell division and playing a crucial role in maintaining outer membrane integrity. This system, comprised of five core proteins—TolA, TolQ, TolR in the inner membrane, TolB in the periplasm, and Pal in the outer membrane—forms a sophisticated network that connects the inner and outer membranes to the peptidoglycan layer. Pal protein, in particular, exhibits a robust association with the peptidoglycan, highlighting its significance in the structural and functional interplay within the Tol-Pal system.

Others

E. coli

N-SUMO;N-6*His

P26493 (C22-R176)

57036037

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Approximately 36 kDa, The reducing (R) protein migrates as 36 kDa in SDS-PAGE may be due to relative charge.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.