Pal Protein, Legionella pneumophila (His-SUMO)

Cat. No.: HY-P71467: FAQs
Data Sheet
SDS

COA
Handling Instructions Technical Support

Protein solubilization and storage

Help & FAQs

Pal protein, part of the Tol-Pal system, is pivotal in outer membrane invagination and maintenance of integrity during cell division. Integrated with TolA, TolQ, TolR, and TolB, the system connects inner and outer membranes to the peptidoglycan layer. Pal's strong association with peptidoglycan underscores its crucial role in the structural and functional dynamics of the Tol-Pal system. Pal Protein, Legionella pneumophila (His-SUMO) is the recombinant Pal protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Pal Protein, Legionella pneumophila (His-SUMO) is 155 a.a., with molecular weight (affected by relative charge) of ~36 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Price	Stock	Quantity
Free Sample		Apply now
5 μg	USD 130	In-stock	Estimated Time of Arrival: March 24
10 μg	USD 220	In-stock	Estimated Time of Arrival: March 24
50 μg	USD 620	In-stock	Estimated Time of Arrival: March 24
100 μg		Get quote

Get it March 24 by noon. Order within 17 hrs 54 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Biological Activity
Technical Parameters
Properties
Documentation

Description	Pal protein, part of the Tol-Pal system, is pivotal in outer membrane invagination and maintenance of integrity during cell division. Integrated with TolA, TolQ, TolR, and TolB, the system connects inner and outer membranes to the peptidoglycan layer. Pal's strong association with peptidoglycan underscores its crucial role in the structural and functional dynamics of the Tol-Pal system. Pal Protein, Legionella pneumophila (His-SUMO) is the recombinant Pal protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Pal Protein, Legionella pneumophila (His-SUMO) is 155 a.a., with molecular weight (affected by relative charge) of ~36 kDa.
Background	Pal protein is an integral component of the Tol-Pal system, contributing to outer membrane invagination during cell division and playing a crucial role in maintaining outer membrane integrity. This system, comprised of five core proteins—TolA, TolQ, TolR in the inner membrane, TolB in the periplasm, and Pal in the outer membrane—forms a sophisticated network that connects the inner and outer membranes to the peptidoglycan layer. Pal protein, in particular, exhibits a robust association with the peptidoglycan, highlighting its significance in the structural and functional interplay within the Tol-Pal system.
Species	Others
Source	E. coli
Tag	N-SUMO;N-6*His
Accession	P26493 (C22-R176)
Gene ID	57036037
Molecular Construction	N-term 6*His-SUMO Pal (C22-R176) Accession # P26493 C-term
Synonyms	pal; pplA; Peptidoglycan-associated lipoprotein; PAL; 19kDa surface antigen; PPL
AA Sequence	CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR
Molecular Weight	Approximately 36 kDa, The reducing (R) protein migrates as 36 kDa in SDS-PAGE may be due to relative charge.
Purity	Greater than 90% as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder.
Formulation	Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (235 KB) SDS (251 KB) COA (220 KB) Handling Instructions (2659 KB)

Pal Protein, Legionella pneumophila (His-SUMO) Related Classifications

Others

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?
1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.
How should solution-form recombinant proteins be stored?
1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that
Why is it necessary to add carrier proteins?
Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.
Carrier protein types and options?
In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

Reconstitution Calculator
Dilution Calculator
Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)	=	Mass (in vial)	÷	Desired Reconstitution Concentration
	=		÷

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Specific Activity (Unit/mg)	=	10⁶	÷	Biological Activity (ED₅₀)
Unit/mg	=	10⁶	÷	ng/mL

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Country or Region *

Email Address *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Pal Protein, Legionella pneumophila (His-SUMO)

Biological Activity

Technical Parameters

Properties

Documentation

Pal Protein, Legionella pneumophila (His-SUMO) Related Classifications

Reconstitution Calculator

Dilution Calculator

Specific Activity Calculator

The reconstitution calculator equation

The dilution calculator equation

The specific activity calculator equation

Your Recently Viewed Products:

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report