PCNA Protein, Human (sf9, His)

PCNA, an atypical member of the sulfotransferase family, displays notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and minimal catalytic activity towards substrates like L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Its precise function remains elusive, but PCNA is suggested to participate in drug and neurotransmitter metabolism within the central nervous system (CNS). PCNA Protein, Human (sf9, His) is the recombinant human-derived PCNA protein, expressed by Sf9 insect cells, with N-His labeled tag. The total length of PCNA Protein, Human (sf9, His) is 261 a.a., with molecular weight of ~36 kDa.

SULT4A1, an atypical member of the sulfotransferase family, exhibits notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and displays minimal catalytic activity towards various substrates, including L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. While its precise function remains elusive, SULT4A1 is suggested to play a role in the metabolism of drugs and neurotransmitters within the central nervous system (CNS).

Human

Sf9 insect cells

N-His

P12004 (M1-S261)

5111  [NCBI]

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Approximately 36 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Na₃PO₄, 300 mM NaCl, 10% Glycerol, pH 7.0, 2 mM DTT.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.