PD-L1 Protein, Cynomolgus (HEK293, Fc)

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of PD-L1 Protein, Cynomolgus (HEK293, Fc) is 221 a.a., with molecular weight of ~73.0 kDa.

CD274 molecule is also known as programmed death ligand 1 (PD-L1), and PD-L1 binds to the inhibitory checkpoint molecule PD-1 and interacts with phosphatase (SHP-1 or SHP-2) through the immune receptor tyrosinyl switch Motif (ITSM) to transmit inhibitory signals. The binding of PD-L1 to its receptor PD-1 on T cells transmits signals that inhibit TCR-mediated IL-2 production and T cell proliferation. By inhibiting ZAP70 phosphorylation and its association with CD3ζ. PD-1 signaling attenuates PKC-θ-activated ring phosphorylation (caused by TCR signaling), which is required for the activation of the transcription factors NF-κB and AP-1 and the production of IL-2. PD-L1 binding to PD-1 is also induced by the upregulation of the E3 ubiquitin ligase CPL-B. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence^[1][2][3][4].

1.Immobilized Cynomolgus PD-L1-Fc at 2 μg/mL (100 μL/well) can bind Anti-Human PDL1 mAb.The ED₅₀ of Anti-Human PDL1 mAb is 8.15 ng/mL. (Regularly tested)
2.Loaded Biotinylated Human PD-1-His-Avi on SA Biosensor, can bind Cynomolgus PD-L1-Fc with an affinity constant of 14.1 nM as determined in BLI assay. (Regularly tested)

Cynomolgus

HEK293

C-hFc

G7PSE7 (F19-T239)

102145573  [NCBI]

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

Approximately 73.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.