PDGF-BB Protein, Mouse (C-His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

The PDGF-BB Protein is a pivotal member of the PDGF/VEGF growth factor family, indicating its crucial role in cellular signaling and tissue development. As part of this growth factor family, PDGF-BB likely shares conserved structural and functional characteristics with related proteins, contributing to cell growth, angiogenesis, and vascular development. Its membership in the PDGF/VEGF growth factor family highlights its significance in orchestrating essential physiological processes necessary for tissue homeostasis. The study of PDGF-BB provides insights into its specific functions within the context of the growth factor family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in vascular development and maintenance. Further exploration of PDGF-BB's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

Mouse

E. coli

P31240 (S82-T190)

18591

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.