PDGF-CC Protein, Cynomolgus (HEK293, hFc)

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag. The total length of PDGF-CC Protein, Cynomolgus (HEK293, hFc) is 111 a.a., with molecular weight of ~45 kDa.

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which is required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. PDGF-CC is also required for normal skin morphogenesis during embryonic development. PDGF-CC plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. PDGF-CC plays an important role in angiogenesis and blood vessel development and is involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain of PDGF-CC has mitogenic activity in coronary artery smooth muscle cells^[1][2][3].

Measured in a cell proliferation assay using NIH/3T3 cells. The ED₅₀ for this effect is 15.09 ng/mL, corresponding to a specific activity is 66269.052 units/mg.

• 
  Measured in a cell proliferation assay using NIH/3T3 cells. The ED₅₀ for this effect is 15.09 ng/mL, corresponding to a specific activity is 66269.052 units/mg.

Cynomolgus

HEK293

N-hFc

EHH54037 (V196-G306)

/

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Approximately 45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.