PDIA5 Protein, Human (HEK293, His)

PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293, with C-6*His labeled tag. The total length of PDIA5 Protein, Human (HEK293, His) is 241 a.a., with molecular weight of ~30 kDa.

The PDIA5 protein is responsible for catalyzing the rearrangement of disulfide (-S-S-) bonds in proteins. This important function allows for the proper folding and stabilization of proteins by facilitating the correct formation of disulfide bonds. PDIA5 plays a crucial role in maintaining protein structure and function, ensuring that proteins are correctly folded and can perform their designated biological tasks effectively.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

Q14554-2 (S22-L262)

10954  [NCBI]

SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL

Approximately 30 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.