1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PDIA5 Protein, Human (HEK293, His)

PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293, with C-6*His labeled tag. The total length of PDIA5 Protein, Human (HEK293, His) is 241 a.a., with molecular weight of ~30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDIA5 Protein catalyzes the rearrangement of disulfide bonds in proteins, ensuring proper folding and stabilization. Its vital role maintains protein structure and function, guaranteeing effective performance of designated biological tasks through correct disulfide bond formation. PDIA5 Protein, Human (HEK293, His) is the recombinant human-derived PDIA5 protein, expressed by HEK293, with C-6*His labeled tag. The total length of PDIA5 Protein, Human (HEK293, His) is 241 a.a., with molecular weight of ~30 kDa.

Background

The PDIA5 protein is responsible for catalyzing the rearrangement of disulfide (-S-S-) bonds in proteins. This important function allows for the proper folding and stabilization of proteins by facilitating the correct formation of disulfide bonds. PDIA5 plays a crucial role in maintaining protein structure and function, ensuring that proteins are correctly folded and can perform their designated biological tasks effectively.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14554-2 (S22-L262)

Gene ID
Molecular Construction
N-term
PDIA5 (S22-L262)
Accession # Q14554-2
6*His
C-term
Synonyms
Protein disulfide-isomerase A5; Protein disulfide isomerase-related protein; PDIA5; PDIR
AA Sequence

SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL

Molecular Weight

Approximately 30 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PDIA5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDIA5 Protein, Human (HEK293, His)
Cat. No.:
HY-P71192
Quantity:
MCE Japan Authorized Agent: