PEDF Protein, Human

PEDF Protein, Human is a secreted glycoprotein and a non-inhibitory member of the serine protease inhibitor (serpin) family.

Pigment Epithelium-derived Factor belongs to the serine protease inhibitor (serpin) family. The Pigment Epithelium-derived Factor gene contains a typical signalpeptide sequence, initiator methionine codon, and polyadenylylation signal and matches the size of other members of the serpin superfamily. Pigment Epithelium-derived Factor is a neurotrophic agent^[1]. It is widely expressed in human fetal and adult tissues but its expression decreases with age and in malignant tissues. The main anticancer activities of Pigment Epithelium-derived Factor derive from its dual effects, either indirectly on the tumor microenvironment (indirect antitumor action) or directly on the tumor itself (direct antitumor influence)^[2]. Pigment Epithelium-derived Factor has complex neurotrophic, neuroprotective, anti-angiogenic, anti-oxidative, and anti-inflammatory properties, and could potentially be exploited as a therapeutic option for the treatment of vascular complications in diabetes^[3].

The ED₅₀ is <2 ng/mL as measured by human Saos2 cells, corresponding to a specific activity of >5.0 × 10⁵ IU/mg.

Human

E. coli

Tag Free

P36955 (Q20-P418)

5176  [NCBI]

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

40-49 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Steele FR, et al. Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family. Proc Natl Acad Sci U S A. 1993 Feb 15;90(4):1526-30.  [Content Brief]

  [2]. Belkacemi L, et al. Anti-tumor effects of pigment epithelium-derived factor (PEDF): implication for cancer therapy. A mini-review. J Exp Clin Cancer Res. 2016 Jan 8;35:4.  [Content Brief]

  [3]. Yamagishi S, et al. Pigment epithelium-derived factor (PEDF): its potential therapeutic implication in diabetic vascular complications. Curr Drug Targets. 2008 Nov;9(11):1025-9.  [Content Brief]