1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Peroxiredoxin-2/PRDX2 Protein, Human (His)

Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag. The total length of Peroxiredoxin-2/PRDX2 Protein, Human (His) is 197 a.a., with molecular weight of ~25.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Peroxiredoxin-2/PRDX2 Protein, Human (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag. The total length of Peroxiredoxin-2/PRDX2 Protein, Human (His) is 197 a.a., with molecular weight of ~25.8 kDa.

Background

Peroxiredoxin-2 (PRDX2), a thiol-specific peroxidase, serves as a catalyst in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its vital role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX2 may also participate in the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular concentrations of H(2)O(2). This versatile protein underscores its significance in cellular redox regulation and stress response pathways.

Species

Human

Source

E. coli

Tag

N-His

Accession

P32119 (A2-N198)

Gene ID
Molecular Construction
N-term
His
PRDX2 (A2-N198)
Accession # P32119
C-term
Synonyms
Epididymis secretory sperm binding protein Li 2a; HEL S 2a; MGC4104; Natural killer cell enhancing factor B; Natural killer cell-enhancing factor B; Natural Killer Enhancing Factor B; NKEF B; NKEF-B; NKEFB; Peroxiredoxin 2; Peroxiredoxin-2; PRDX 2; PRDX2; PrP; PRX2; PRXII; PTX1; TDPX1; Thiol Specific Antioxidant 1 ; Thiol specific antioxidant protein; Thiol-specific antioxidant protein; Thioredoxin Dependent Peroxide Reductase 1; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; Torin; TPX1; TSA
AA Sequence

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Molecular Weight

Approximately 25.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Peroxiredoxin-2/PRDX2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peroxiredoxin-2/PRDX2 Protein, Human (His)
Cat. No.:
HY-P71464
Quantity:
MCE Japan Authorized Agent: