1. Recombinant Proteins
  2. Others
  3. PEX19 Protein, Human (GST)

PEX19 protein is pivotal in early peroxisomal biogenesis, acting as a cytosolic chaperone and import receptor for peroxisomal membrane proteins (PMPs). It binds to and stabilizes newly synthesized PMPs in the cytoplasm, particularly their hydrophobic domains. PEX19 targets PMPs to the peroxisome membrane by associating with integral membrane protein PEX3. Engaging in diverse interactions with peroxisomal membrane proteins and other components, PEX19 facilitates peroxisomal assembly. Additionally, it contributes to nuclear exclusion of CDKN2A, preventing TP53 degradation by MDM2 and interacting with tumor suppressor CDKN2A/p19ARF in intricate cellular processes. PEX19 Protein, Human (GST) is the recombinant human-derived PEX19 protein, expressed by E. coli, with N-GST labeled tag. The total length of PEX19 Protein, Human (GST) is 295 a.a., with molecular weight of 59.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PEX19 protein is pivotal in early peroxisomal biogenesis, acting as a cytosolic chaperone and import receptor for peroxisomal membrane proteins (PMPs). It binds to and stabilizes newly synthesized PMPs in the cytoplasm, particularly their hydrophobic domains. PEX19 targets PMPs to the peroxisome membrane by associating with integral membrane protein PEX3. Engaging in diverse interactions with peroxisomal membrane proteins and other components, PEX19 facilitates peroxisomal assembly. Additionally, it contributes to nuclear exclusion of CDKN2A, preventing TP53 degradation by MDM2 and interacting with tumor suppressor CDKN2A/p19ARF in intricate cellular processes. PEX19 Protein, Human (GST) is the recombinant human-derived PEX19 protein, expressed by E. coli, with N-GST labeled tag. The total length of PEX19 Protein, Human (GST) is 295 a.a., with molecular weight of 59.3 kDa.

Background

PEX19 protein plays a crucial role in early peroxisomal biogenesis, serving both as a cytosolic chaperone and an import receptor for peroxisomal membrane proteins (PMPs). Its function involves binding to and stabilizing newly synthesized PMPs in the cytoplasm, particularly through interactions with their hydrophobic membrane-spanning domains. Subsequently, PEX19 targets these PMPs to the peroxisome membrane by associating with the integral membrane protein PEX3. Notably, PEX19 engages in diverse protein-protein interactions, forming complexes with a spectrum of peroxisomal membrane proteins, such as PEX10, PEX11A, PEX11B, PEX12, PEX13, PEX14, and PEX16, as well as other crucial components like PXMP2/PMP22, PXMP4/PMP24, SLC25A17/PMP34, ABCD1/ALDP, ABCD2/ALDRP, and ABCD3/PMP70. Additionally, PEX19 plays a role in nuclear exclusion of CDKN2A, preventing its interaction with MDM2 and consequently facilitating the degradation of TP53. Furthermore, it interacts with the tumor suppressor CDKN2A/p19ARF, highlighting its involvement in intricate cellular processes.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P40855 (A2-C296)

Gene ID
Molecular Construction
N-term
GST
PEX19 (A2-C296)
Accession # P40855
C-term
Synonyms
PEX19; peroxisomal biogenesis factor 19; peroxisomal farnesylated protein , PXF; D1S2223E; HK33; housekeeping gene; 33kD; PMP1; PMPI; PXMP1; peroxin-19; housekeeping gene, 33kD; 33 kDa housekeeping protein; peroxisomal farnesylated protein; PXF; FLJ55296;
AA Sequence

AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC

Molecular Weight

59.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PEX19 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PEX19 Protein, Human (GST)
Cat. No.:
HY-P700383
Quantity:
MCE Japan Authorized Agent: