PFDN4 Protein, Human (His)

The PFDN4 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN4 Protein, Human (His) is the recombinant human-derived PFDN4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PFDN4 Protein, Human (His) is 134 a.a., with molecular weight of 18-20 kDa.

PFDN4 protein exhibits precise binding to cytosolic chaperonin (c-CPN), facilitating the targeted transfer of proteins to this chaperone. Additionally, PFDN4 binds to nascent polypeptide chains, actively promoting their proper folding within a cellular environment characterized by numerous competing pathways for nonnative proteins. As a heterohexamer composed of two PFD-alpha type and four PFD-beta type subunits, PFDN4 plays a crucial role in cellular protein homeostasis. Notably, it interacts with URI1 in a phosphorylation-dependent manner, and this interaction is modulated in a growth-dependent fashion, emphasizing the dynamic nature of its cellular functions.

Human

E. coli

N-6*His

Q9NQP4 (M1-S134)

5203  [NCBI]

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

18-20 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.