1. Recombinant Proteins
  2. Others
  3. PFDN5 Protein, Human (His)

PFDN5 protein selectively binds to cytosolic chaperonin (c-CPN), facilitating targeted protein transfer and promoting nascent polypeptide folding. Beyond its chaperone function, PFDN5 regulates MYC transcriptional activity by forming a heterohexamer. It interacts with MYC's N-terminal domain, showcasing a multifaceted role in cellular processes, bridging protein folding and transcriptional regulation. PFDN5 Protein, Human (His) is the recombinant human-derived PFDN5 protein, expressed by E. coli , with N-His labeled tag. The total length of PFDN5 Protein, Human (His) is 154 a.a., with molecular weight of ~20 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PFDN5 protein selectively binds to cytosolic chaperonin (c-CPN), facilitating targeted protein transfer and promoting nascent polypeptide folding. Beyond its chaperone function, PFDN5 regulates MYC transcriptional activity by forming a heterohexamer. It interacts with MYC's N-terminal domain, showcasing a multifaceted role in cellular processes, bridging protein folding and transcriptional regulation. PFDN5 Protein, Human (His) is the recombinant human-derived PFDN5 protein, expressed by E. coli , with N-His labeled tag. The total length of PFDN5 Protein, Human (His) is 154 a.a., with molecular weight of ~20 kDa.

Background

PFDN5 protein demonstrates targeted binding to cytosolic chaperonin (c-CPN), facilitating the transfer of specific proteins to this chaperone. Additionally, PFDN5 binds to nascent polypeptide chains, actively supporting their proper folding within a cellular environment teeming with competing pathways for nonnative proteins. Beyond its chaperone function, PFDN5 plays a regulatory role by repressing the transcriptional activity of MYC. Structurally, PFDN5 forms a heterohexamer comprising two PFD-alpha type and four PFD-beta type subunits. Notably, it engages in specific interactions with the N-terminal domain of MYC, suggesting a multifaceted role for PFDN5 in cellular processes, encompassing both protein folding and transcriptional regulation.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q99471 (M1-A154)

Gene ID
Molecular Construction
N-term
His
PFDN5 (M1-A154)
Accession # Q99471
C-term
Synonyms
Prefoldin subunit 5; Myc modulator 1; PFDN5; MM1; PFD5
AA Sequence

MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

Molecular Weight

Approximately 20 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PFDN5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PFDN5 Protein, Human (His)
Cat. No.:
HY-P76542
Quantity:
MCE Japan Authorized Agent: