PfLDH Protein, P. falciparum (His)

pfHPRT Protein, part of the LDH/MDH superfamily, is specified. PfLDH Protein, P. falciparum (His) is the recombinant PfLDH protein, expressed by E. coli, with C-His labeled tag. The total length of PfLDH Protein, P. falciparum (His) is 316 a.a., with molecular weight of ~34.9 KDa.

pfHPRT belongs to the LDH/MDH superfamily.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Others

E. coli

C-His

Q76NM3 (M1-A316)

814112  [NCBI]

MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA

Approximately 34.9 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.