PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

The PGD2 Synthase/PTGDS protein serves as a catalyst for the conversion of PGH2 to PGD2, a prostaglandin that plays a crucial role in smooth muscle contraction/relaxation and acts as a potent inhibitor of platelet aggregation. It is implicated in various central nervous system (CNS) functions, including sedation, NREM sleep, PGE2-induced allodynia, and potentially acts as an anti-apoptotic factor in oligodendrocytes. Additionally, this protein binds to small non-substrate lipophilic molecules such as biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially functioning as a scavenger for harmful hydrophobic compounds and acting as a secretory transporter for retinoids and thyroid hormones. It is likely involved in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers. Furthermore, it plays significant roles in the maturation and maintenance of the central nervous system and male reproductive system. It is also engaged in the maturation of mast cells through its involvement in the PLA2G3-dependent pathway, where PLA2G3 secreted by immature mast cells acts on neighboring fibroblasts upstream of PTGDS, leading to the synthesis of PGD2, which ultimately promotes mast cell maturation and degranulation via PTGDR.

Measured by its ability to catalyse the conversion of PGH2 to PGD2. The specific activity is 4.878 pg/min/µg that incubate at 25 ºC for 1 minutes.

Mouse

HEK293

C-6*His

NP_032989.2 (Q25-E189)

19215  [NCBI]

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Approximately 26-32 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.