PHGDH Protein, Human (C-His)

PHGDH protein plays a key role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the first step in the phosphorylated L-serine biosynthetic pathway.PHGDH Protein, Human (C-His) is the recombinant human-derived PHGDH protein, expressed by E.coli , with C-6*His labeled tag.

PHGDH (Phosphoglycerate dehydrogenase) is an enzyme that plays a crucial role in cellular metabolism by catalyzing the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, marking the initial step in the phosphorylated L-serine biosynthesis pathway. This pathway is essential for the production of L-serine, a precursor for various cellular components, including nucleotides and proteins. In addition to its role in serine biosynthesis, PHGDH exhibits versatile enzymatic activities, including the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate. These additional activities suggest PHGDH's involvement in regulating metabolic flux and maintaining cellular redox balance. Understanding the functions of PHGDH provides insights into the intricate network of metabolic pathways and highlights its significance in supporting fundamental cellular processes.

Measured by the ability to catalyze the oxidation of 3-phospho-D-glycerate.which can be measured by absorbance at 340 nm. The specific activity is 3159.161 pmol/min/µg, as measured under the described conditions.

Human

E. coli

C-6*His

O43175 (M1-F533)

26227  [NCBI]

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Approximately 57 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.