1. Recombinant Proteins
  2. Receptor Proteins
  3. PILR-alpha Protein, Human (178a.a, HEK293, Fc)

PILR-alpha Protein, Human (178a.a, HEK293, Fc)

Cat. No.: HY-P78022
Handling Instructions Technical Support

PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PILR-alpha, belonging to the paired receptors family, functions as a cellular signaling inhibitory receptor with a role in immune system regulation. This receptor is presumed to exert its inhibitory effects by recruiting cytoplasmic phosphatases such as PTPN6/SHP-1 and PTPN11/SHP-2 through their SH2 domains, leading to signal transduction blockage via dephosphorylation of key signaling molecules. Additionally, PILR-alpha serves as a receptor for PIANP and, under conditions of microbial infection, acts as an entry co-receptor for herpes simplex virus 1. Its engagement in these molecular interactions highlights its versatile involvement in immune modulation and cellular responses to pathogens.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9UKJ1-1 (Q20-A197)

Gene ID
Molecular Construction
N-term
PILR-alpha (Q20-A197)
Accession # Q9UKJ1-1
hFc
C-term
Synonyms
PILRA; FDF03; PILRalpha; PILR-alpha
AA Sequence

QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA

Molecular Weight

60-70 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PILR-alpha Protein, Human (178a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PILR-alpha Protein, Human (178a.a, HEK293, Fc)
Cat. No.:
HY-P78022
Quantity:
MCE Japan Authorized Agent: