PIN/DYNLL1 Protein, Human (His)

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli, with N-6*His labeled tag. The total length of PIN/DYNLL1 Protein, Human (His) is 89 a.a., with molecular weight of ~14.0 kDa.

PIN/DYNLL1 serves as a non-catalytic accessory component within the cytoplasmic dynein 1 complex, contributing to the linkage between dynein and its associated cargos and adapter proteins that modulate dynein activity. As part of the cytoplasmic dynein 1 complex, it functions as a motor for the retrograde movement of vesicles and organelles along microtubules. PIN/DYNLL1 likely plays a role in shaping or preserving the spatial arrangement of cytoskeletal structures. Additionally, it is involved in enhancing the transactivation functions of ESR1 and contributes to the nuclear localization of ESR1.

Human

E. coli

N-6*His

P63167 (M1-G89)

8655  [NCBI]

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.