PIST Protein, Human (His)

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

PIST (PDZ domain-containing protein that interacts with Stx6) plays a crucial role in intracellular protein trafficking and degradation, as evidenced by its involvement in diverse cellular processes. It is implicated in the regulation of CFTR chloride currents and acid-induced ASIC3 currents, potentially modulating the cell surface expression of both channels. Moreover, PIST is associated with the intracellular trafficking of the ADR1B receptor and may contribute to autophagy regulation. In collaboration with MARCHF2, PIST mediates the ubiquitination and lysosomal degradation of CFTR, leading to its intracellular retention and subsequent lysosomal degradation. The protein forms homooligomers and engages in a network of interactions with various partners, including FZD5, FZD8, GRID2, BECN1, CSPG5, CLCN3, STX6, CFTR, ASIC3, GOLGA3, NLGN1, RHOQ, MARCHF2, ADRB1, and potentially CACNG2 and CCDC62, highlighting its multifaceted roles in cellular trafficking and signaling pathways.

Human

E. coli

N-His

Q9HD26-1 (I286-Y462)

57120  [NCBI]

IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Approximately 25 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.