1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G2D Protein, Human (His-SUMO)

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

PLA2G2D Protein, Human (His-SUMO) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

PLA2G2D is a secretory calcium-dependent phospholipase A2 with a primary focus on extracellular lipids, showcasing anti-inflammatory and immunosuppressive functions. This protein hydrolyzes the ester bond of the fatty acyl group at the sn-2 position of phospholipids, displaying a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. Particularly in draining lymph nodes, it selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids like eicosapentaenoate and docosahexaenoate. These compounds act as precursors for the synthesis of anti-inflammatory lipid mediators known as resolvins. During the resolution phase of acute inflammation, PLA2G2D drives the synthesis of resolvin D1 derived from docosahexaenoate, suppressing dendritic cell activation and the T-helper 1 immune response. Beyond its catalytic activity, PLA2G2D, via mechanisms independent of its enzymatic functions, promotes the differentiation of regulatory T cells (Tregs) and contributes to maintaining immune tolerance. Additionally, it may play a role in lipid remodeling of cellular membranes and participate in the generation of lipid mediators crucial for pathogen clearance, exhibiting bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids in the bacterial membrane.

Biological Activity

Measured by its ability to hydrolyze 20 μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine. The specific activity is >5 pmol/min/μg that at room temperature in kinetic mode for 5 minutes.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q9UNK4 (I22-C145)

Gene ID
Molecular Construction
N-term
6*His-SUMO
PLA2G2D (22I-145C)
Accession # Q9UNK4
C-term
Synonyms
2IID; EC 3.1.1.4; GIID sPLA2; Group IID secretory phospholipase A2; Phospholipase A2 group IID ; Pla2g2d; PLA2IID; stroma-associated homolog
AA Sequence

ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 20 mM HEPES, 150 mM NaCl, pH 8.2, 0.2% CHAPS, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLA2G2D Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLA2G2D Protein, Human (His-SUMO)
Cat. No.:
HY-P71653
Quantity:
MCE Japan Authorized Agent: