1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. Platelet Factor 4
  6. PF-4/CXCL4 Protein, Mouse

Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.

Background

Platelet factor 4 (PF4) is a protein released during platelet aggregation, exerting its influence on various physiological processes. It plays a crucial role in neutralizing the anticoagulant effect of heparin by exhibiting a higher binding affinity to heparin compared to the chondroitin-4-sulfate chains of the carrier molecule. Beyond its anticoagulant properties, PF4 demonstrates chemotactic effects on neutrophils and monocytes, contributing to immune responses. Additionally, PF4 acts to inhibit endothelial cell proliferation, suggesting a role in the regulation of vascular processes. Structurally, PF4 forms a homotetramer, and it interacts with TNFAIP6, specifically engaging with its Link domain. This intricate interplay highlights the multifaceted functions of PF4 in hemostasis, immune response, and vascular regulation.

Biological Activity

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 10-100 ng/mL.
2.Measured by its ability to inhibit the FGF basic-dependent proliferation of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is ≤0.2517 μg/mL, corresponding to a specific activity is ≥3.97×103 U/mg.

  • Measured by its ability to inhibit the FGF basic-dependent proliferation of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 0.2517 μg/mL, corresponding to a specific activity is 3.97×103 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9Z126 (V30-S105)

Gene ID
Molecular Construction
N-term
Platelet factor 4 (V30-S105)
Accession # Q9Z126
C-term
Synonyms
Pf4; Cxcl4; Scyb4; Platelet factor 4; PF-4; C-X-C motif chemokine 4
AA Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Weight

Approximately 8.2-12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PF-4/CXCL4 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PF-4/CXCL4 Protein, Mouse
Cat. No.:
HY-P71885
Quantity:
MCE Japan Authorized Agent: